highSchool22 highSchool22

07-03-2017
Computers and Technology

contestada

Which was the first console with a programmable microprocessor and a ROM chip?

Respuesta :

smgaunt smgaunt

03-06-2019

Answer:

Fairchild VES

Explanation:

Answer Link

Otras preguntas

What is a repeater, based on the provided definition? A) A device that increases the speed of data transmission B) An electronic device that amplifies signals

A leaf bag has a capacity of 30 gallons. What percentage of its capacity is 27 gallons?

A 28-year-old woman on oral contraceptives develops tachypnea and reports dyspnea. A ventilation/perfusion scan is ordered to check for pulmonary thromboemboli.

Calculate the total current in a circuit with 2-ohm, 4-ohm, 3-ohm resistors connected in series with a 110-V source. a. 15.7 A b. 22.5 A c. 7.1 A d. 30.0 A

For the peptide YALGIIQAQPDKSESELVSQIIEELIKKEK, predict the electrospray ionization mass spectrum. Assume that the molecular weight of the uncharged peptide is

In terms of class stratification, the US traditionally has a? Whereas India traditionally has a(n) system. Select one: O a. Closed; Open O b. Open; Closed O c.

Jillian is participating in an experiment in which she is asked to shadow a message presented to the left ear. What is the purpose of this experiment? 1) To tes

Given that a mile is equal to 1600 m, what is the correct conversion of a speed of 25 mph to the same speed in m/s?a) 11.17 m/sb) 16.09 m/sc) 40.00 m/sd) 64.37

Use a desmos to estimate the local extrema of the function.f(x) =x⁴+2x³-2x²

A lightning bolt strikes an airplane with 40 kA for 1 ms. How many coulombs of charge are deposited on the plane? The amount of charge deposited on the plane is