rivers89
rivers89 rivers89
  • 06-04-2021
  • Mathematics
contestada

Simplify (-3/5) divided by (7/6)

Respuesta :

suorytouday
suorytouday suorytouday
  • 06-04-2021

-18/35 is the answer to (-3/5) divided by (7/6)

Answer Link

Otras preguntas

Incorrecto or correcto: ella no entendie lo que dices
advantages of non-traditional sports to traditional sports?
Helpppp fastttt Plz show allll workkkkk
These symbols organize pitches for high or low instruments and voices;A. Clocks B. Clefs C. Cliffs​
HOW MANY BURGERS CAN BE MADE WITH 1 BILLION COWS ( 1,000,000,000) ???? each cow can make 1,200 burgers
Sunlight is made up of EM waves. True or False
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
PLS HELP!!! In section VIII, the Code of Justinian makes a connection between being subject to a master and being subject to a parent. Compare and contrast slav
If a student is asked to describe the location of Georgia in relation to the rest of the world on a Mercator projection, which of these responses would be corre
The price of a Technology stock was $9.73 yesterday today the price Rose to $9.80 find the percentage increase round your answer to the nearest tenth of a perce