lilyrockstarmag
lilyrockstarmag lilyrockstarmag
  • 09-05-2018
  • Mathematics
contestada

What is the surface area of the prism

What is the surface area of the prism class=

Respuesta :

danielfedorov02
danielfedorov02 danielfedorov02
  • 17-05-2018
Surface Area = 24×9+20×15×2+24×20=1296in²
Answer Link

Otras preguntas

What is -5n+7<57 and 6n+2<8
In a school of 200 students, 90 students are in the marching band, 145 students are on sports teams and 75 students participate in both activities. How many stu
You are the new VP for HR of a company that has not been performing well, and everyone including youself, has a mandate to deliver results. The pressure has nev
Find an equation of the line that has a slope of 10 and a y intercept of 1. Write your answer in the form y = mx + b.
Can anybody please help me out with this question I would really appreciate it so much. Please and thank you .
Which two steps were taken by the British for the development of Calcutta?
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
What do good readers do, especially when they don’t comprehend the text?
Complete the solution of the equation. Find the value of y when x equals -8. 3x + 5y = -59
A factory can produce 60 TVs in 7 days. How long does it take to finish 400 TVs?​